DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:261 Identity:88/261 - (33%)
Similarity:114/261 - (43%) Gaps:46/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :..||..|..|..|..||.|||  ..||.....||||:|...:|||||||...|....||.|||.
  Fly    33 INGRIVNGYPAYEGKAPYTVGL--GFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATW 95

  Fly   138 FADVEDSVEELQVTHR----DFI---IYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFM 195
            ..:.       |.||.    |||   .:|:..|    :|:||||.|. |.....|..:||.....
  Fly    96 RTNA-------QFTHTVGSGDFIQNHNWPNQNG----NDIALIRTPH-VDFWHMVNKVELPSFND 148

  Fly   196 HQNFLVGKVVTLSGWGY--LGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH------- 251
            ..|..........|||.  .|...|    .::.:|.::|....|          .|.:       
  Fly   149 RYNMYDNYWAVACGWGLTTAGSQPD----WMECVDLQIISNSEC----------SRTYGTQPDGI 199

  Fly   252 LCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTA 316
            ||...|.|:..|:||||||:|.|  :...|:||||:.|..||..|.|:.:||:|..|.|||..:.
  Fly   200 LCVSTSGGKSTCSGDSGGPLVLH--DGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSG 262

  Fly   317 M 317
            :
  Fly   263 V 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 85/250 (34%)
Tryp_SPc 77..314 CDD:238113 87/252 (35%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 85/250 (34%)
Tryp_SPc 37..260 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
76.830

Return to query results.
Submit another query.