DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:251 Identity:85/251 - (33%)
Similarity:119/251 - (47%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :..||..|..|..|..||.|||  ..||.  ..||||:|...:||||.||:.||.:..:|.|||.
  Fly    33 IEGRITNGYAAPEGKAPYTVGL--GFSGG--WWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATW 93

  Fly   138 FADVEDSVEELQVTHRDFIIYPDYLGFGGY-----SDLALIRLPRKVRTSEQVQPIELAGEFMHQ 197
            ..:.       |.||.        :|.|.:     :|:||||:|. |.....|..:||.......
  Fly    94 RTNA-------QFTHT--------VGNGNFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRY 142

  Fly   198 NFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGA 262
            |..........|||...|.: .....||.:|.:::..|.|...:  |.|.. ..:||...:|:..
  Fly   143 NNYNEWWAVACGWGGTYDGS-PLPDWLQCVDLQIVHNEECGWTY--GSVGD-NVICTRTVDGKSI 203

  Fly   263 CNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318
            |.||||||:|.|  :.|.|:||::|.|:.||:.|.|..:.|:|.:|.|||..|.::
  Fly   204 CGGDSGGPLVTH--DGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTGIS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 81/239 (34%)
Tryp_SPc 77..314 CDD:238113 83/241 (34%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 81/239 (34%)
Tryp_SPc 37..253 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.