DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG3355

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:123/270 - (45%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVK--------CGGSLITLQFVLTAAHCL---TDAIAA 129
            ||.||:......:|:.         |.|||        ||||||..::|||||||:   .|.|..
  Fly    75 RIVGGQQVRSNKYPWT---------AQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITI 130

  Fly   130 KIYTGATVFADVEDSVEELQVTHR--DFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAG 192
            ::       ..::.|..:..:..:  ...::|:|......:|:||::|...|..:..::|:.|. 
  Fly   131 RL-------LQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLP- 187

  Fly   193 EFMHQNFLVGKVVTLSGWGYL--GDSTDKRTRLLQYLDAEVIDQERC-------------ICYFL 242
            |..| || .||...::|||.:  |..|   :..||.::..||...:|             :|   
  Fly   188 EANH-NF-DGKTAVVAGWGLIKEGGVT---SNYLQEVNVPVITNAQCRQTRYKDKIAEVMLC--- 244

  Fly   243 PGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITA 306
            .|||.|         .|:.||.||||||::.:..... |.||.|||  .|| :...|.||.|::.
  Fly   245 AGLVQQ---------GGKDACQGDSGGPLIVNEGRYK-LAGVVSFG--YGCAQKNAPGVYARVSK 297

  Fly   307 YLPWIRQQTA 316
            :|.|||:.||
  Fly   298 FLDWIRKNTA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 77/263 (29%)
Tryp_SPc 77..314 CDD:238113 79/265 (30%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 77/263 (29%)
Tryp_SPc 76..305 CDD:238113 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.