DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG40160

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:316 Identity:86/316 - (27%)
Similarity:119/316 - (37%) Gaps:50/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DDDDAIMERRWQLGYE-----NFRLRCEKFEMEGNQTAAVRTRIAGG----------ELATRGMF 88
            :|||.|......:..:     |..|.....:...||......|..||          ..|..|.|
  Fly   112 NDDDPICPASVDVCCDANRTLNKTLNPTPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEF 176

  Fly    89 PYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGA-TVFA---DVEDSVEELQ 149
            |:.|.|:  .||.....|.||||..|.|||||||:     ..:.||: ||.|   |.:...|.|.
  Fly   177 PWTVALL--HSGNLSYFCAGSLIHKQVVLTAAHCV-----ESLRTGSFTVRAGEWDTQTMKERLP 234

  Fly   150 VTHRD---FIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFL--VGKVVTLSG 209
            ...|.   .|::|||.......|.||:.|.:.|...:.:..|.|.    .|:.:  .|.....:|
  Fly   235 YQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLP----QQDDIPQPGNTCFSTG 295

  Fly   210 WG--YLGDSTDKRTRLLQYLDAEVIDQERCICYFL-----PGLVSQRRHLCTDGSNGRGACNGDS 267
            ||  ..| |..|.:.|::.:...:::...|.....     |.....|..:|..|..|...|.||.
  Fly   296 WGKDAFG-SLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDG 359

  Fly   268 GGPVVY---HWRNVSY-LIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMTN 319
            |.|:..   ..|...| ..|:.::|.  ||....|..|..:.....||.|| .:||
  Fly   360 GAPLACPRGSTRESRYQQTGIVAWGI--GCNDEVPAAYANVALVRGWIDQQ-MLTN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 72/264 (27%)
Tryp_SPc 77..314 CDD:238113 73/266 (27%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 71/255 (28%)
Tryp_SPc 169..405 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.