DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and prss60.3

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:254 Identity:78/254 - (30%)
Similarity:121/254 - (47%) Gaps:18/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT--DAIAAKIYT 133
            |.:.|||.||..|:.|.:|:||.|.....|...  ||||||:.::||||||||:  ......:|.
Zfish    30 APLNTRIVGGVNASPGSWPWQVSLHSPKYGGHF--CGGSLISSEWVLTAAHCLSGVSETTLVVYL 92

  Fly   134 GATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198
            |......:  ::.|.........::..|......:|:||:||...|..:..::|:.||.:  :..
Zfish    93 GRRTQQGI--NIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQ--NSV 153

  Fly   199 FLVGKVVTLSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLC---TDGSNG 259
            :..|....::|||.:....: ....:||.....|:..:||......|.|:... :|   |.|  |
Zfish   154 YSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNM-ICAGLTQG--G 215

  Fly   260 RGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQTAM 317
            :..|.||||||:|.....|....|:||:|  .|| :...|.||||::.|..||..:.::
Zfish   216 KDTCQGDSGGPMVTRLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWISSKISL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/241 (31%)
Tryp_SPc 77..314 CDD:238113 75/243 (31%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 75/243 (31%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.