DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG4259

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:239 Identity:64/239 - (26%)
Similarity:99/239 - (41%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTD------AIAAKIYTGATVFADVED 143
            |..||:.|.::.|..........||||....||||||.|..      .:.|..:..:|.......
  Fly    36 RATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHV 100

  Fly   144 SVEELQ-VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTL 207
            .:|.|. |:|..|      ..|...:::||:.|   |...|....|.|...::.:..:.......
  Fly   101 DLEVLNIVSHEQF------NRFNAENNMALLIL---VSAFEMTANINLIPLYLQEAGIQKGSCFF 156

  Fly   208 SGWG--YLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGP 270
            :|||  || :|||..| :|:.:..:::....|....||  :.|   :|..|..|.. |:||.|.|
  Fly   157 NGWGKVYL-NSTDYPT-VLKTVQVDLLSMGMCSSRKLP--IQQ---ICGKGLEGID-CSGDGGAP 213

  Fly   271 VVYHWRNVSY---LIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311
            :|.......|   .:|:.::.|.:..| ....|:|.:...||||
  Fly   214 LVCRILTYPYKYAQVGIVNWLSQKPVE-NTFIVFTNVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 62/237 (26%)
Tryp_SPc 77..314 CDD:238113 64/239 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 63/236 (27%)
Tryp_SPc 39..256 CDD:214473 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.