DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and f2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:270 Identity:78/270 - (28%)
Similarity:127/270 - (47%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYT------ 133
            :||.||:.|.....|:|| ::.:.|..:|: ||.|||:.:::||||||:......|.:|      
Zfish   372 SRIVGGDEAEVASAPWQV-MLYKRSPQELL-CGASLISDEWILTAAHCILYPPWNKNFTINDIIV 434

  Fly   134 --GATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYS-DLALIRLPRKVRTSEQVQPIELAGEFM 195
              |.......|..:|:: |...:.|::|.|......: |:||:.:.:.|..:.::.|:.|..:.:
Zfish   435 RLGKHSRTKYERGIEKI-VAIDEIIVHPKYNWKENLNRDIALLHMKKPVVFTSEIHPVCLPTKSI 498

  Fly   196 HQNFL-VGKVVTLSGWGYLGDS-TDKRTRL---LQYLDAEVIDQERCICYFLPGLVSQRRHLCT- 254
            .:|.: .|....::|||.|.:| |...|.|   ||.:...::||.  ||.....::......|. 
Zfish   499 AKNLMFAGYKGRVTGWGNLRESWTSNPTNLPTVLQQIHLPIVDQS--ICRNSTSVIITDNMFCAG 561

  Fly   255 ---DGSNGRGACNGDSGGPVVY------HWRNVSYLIGVTSFGSAEGCEVGGP-TVYTRITAYLP 309
               |.|....||.||||||.|.      .|    |.||:.|:|  |||:..|. ..||.:.....
Zfish   562 YQPDDSKRGDACEGDSGGPFVMKSPSDNRW----YQIGIVSWG--EGCDRDGKYGFYTHLFRMRR 620

  Fly   310 WIRQQTAMTN 319
            |:::....|:
Zfish   621 WMKKVIEKTD 630

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 76/259 (29%)
Tryp_SPc 77..314 CDD:238113 76/261 (29%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527