DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8952

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:268 Identity:82/268 - (30%)
Similarity:138/268 - (51%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTD 125
            :.|:...:....:..||..|..|..|.||:||  :::....|.:.||||:|:..:||||||| |:
  Fly    22 QPFDPANSSPIKIDNRIVSGSDAKLGQFPWQV--ILKRDAWDDLLCGGSIISDTWVLTAAHC-TN 83

  Fly   126 AIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDY---LGFGGYSDLALIRLPRKVRTSEQVQP 187
            .:::......||  |:.:: ..|.:|..:.||:|||   |.    :|::||:||..:..|..:|.
  Fly    84 GLSSIFLMFGTV--DLFNA-NALNMTSNNIIIHPDYNDKLN----NDVSLIQLPEPLTFSANIQA 141

  Fly   188 IELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHL 252
            |:|.|::......||.|.|::|:||..|.....:..|.|...|:||...|:..:...:|.... :
  Fly   142 IQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDST-M 205

  Fly   253 CTDGSNG--RGACNGDSGGPVVYH------WRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLP 309
            |..|.:|  ...|.||||||::.:      |:.    ||:.||.:.:.|....|:.|.|::::|.
  Fly   206 CAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQ----IGINSFVAEDQCTYRLPSGYARVSSFLG 266

  Fly   310 WIRQQTAM 317
            :|..:|.:
  Fly   267 FIADKTGI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 79/245 (32%)
Tryp_SPc 77..314 CDD:238113 79/247 (32%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/245 (32%)
Tryp_SPc 38..271 CDD:238113 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.