DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG31780

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:101/249 - (40%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAK--IYTGATVFADVEDS 144
            ||.....|:.|.|:...:.:.:  .||:||....|:||.....:..|::  :..|...|:...:.
  Fly   112 LAQEAEVPWMVALLDARTSSYV--AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ 174

  Fly   145 VEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSG 209
            :..:.|..|..:.:|.:....|.:::||:.|.|.:.:|..:.||.:..  ..:||...:.: .:|
  Fly   175 LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS--APKNFDFSRCI-FTG 236

  Fly   210 WGYLGDSTDKRTRLLQYLDAEVIDQERC----ICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGP 270
            ||...........:|:.:...|:.:..|    ..|:..........:|..|..|:.:|.||.|.|
  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSP 301

  Fly   271 VV---------YHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQT 315
            :.         |.      |.|:.:||...|.. |.|.|||.:...:.||...|
  Fly   302 LACAIKDNPQRYE------LAGIVNFGVDCGLP-GVPAVYTNVANVIEWITLTT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 54/243 (22%)
Tryp_SPc 77..314 CDD:238113 56/246 (23%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 53/242 (22%)
Tryp_SPc 113..344 CDD:238113 53/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.