DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG32755

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:127/273 - (46%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNQTA-----AVRTRIAGGELATRGMFPYQVGLVIQLS------GADLVKCGGSLITLQFVLTAA 120
            |..||     .:..:|.||...|....|:||. |.:.|      |...| |||::|:.:.|.:||
  Fly    23 GQPTATASPFVILPKIVGGYTVTIDQVPFQVS-VRRRSIHERHYGLGHV-CGGAVISQRVVCSAA 85

  Fly   121 HCLT-DAIAAKIYTGATVFADVEDS--VEELQVTHRDFII-----YPDYLGFGGYSDLALIRLPR 177
            ||.. :.....:|....::..|..|  ::......:::::     :.||.|....:|:||:.|..
  Fly    86 HCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG 150

  Fly   178 KVR-TSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC-ICY 240
            .:. .|..|:.|.||.:...:    |....:.|||.:  :..:::..||.....::::|.| :.|
  Fly   151 FIPWESPGVRAIPLAIKAPEE----GTTCLIHGWGKV--TMKEKSASLQQAPVPILNKELCQVIY 209

  Fly   241 FLPGLVSQRRHLCTDG-SNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTR 303
            .||  .||   :|... ..|..||.||||||::...|    |.|:.|:|  .|| :.|.|.|||.
  Fly   210 KLP--ASQ---MCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWG--VGCADPGYPGVYTN 263

  Fly   304 ITAYLPWIRQQTA 316
            ::.:|.|||:..|
  Fly   264 VSHFLKWIRRANA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/252 (28%)
Tryp_SPc 77..314 CDD:238113 74/254 (29%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/252 (28%)
Tryp_SPc 38..273 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.