DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG32523

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:126/260 - (48%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NQT-AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL---TDAIA 128
            ||: :|:..||.||..|.:|.||:|:.|  :|.|...  |||.:|:...|:||.||:   .|.:.
  Fly    27 NQSESAIEPRIVGGIKAKQGQFPHQISL--RLRGEHY--CGGVIISATHVITAGHCVKHGNDVVP 87

  Fly   129 AKIYT---GATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL 190
            |.:::   |:.:.     |.:.:::...:.|::|:| ..||::|||::||...:.....:..|:|
  Fly    88 ADLWSIQAGSLLL-----SSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQL 146

  Fly   191 AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYF---LPGLVSQRRHL 252
            |.| ...|.:   .|.:||||.:.:.......|| ::....|.:..|...|   ||..:     :
  Fly   147 ATE-DPPNCV---AVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSRLPETM-----I 201

  Fly   253 CTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317
            |...|...|||.||||||..|..:    ::|:.|.....||....|..|.||:....||.::..:
  Fly   202 CLLHSKNSGACYGDSGGPATYGGK----VVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262

  Fly   318  317
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 72/243 (30%)
Tryp_SPc 77..314 CDD:238113 73/245 (30%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/243 (30%)
Tryp_SPc 37..219 CDD:238113 60/201 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.