DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG32376

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:105/249 - (42%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGA---- 135
            |||..|:.......|:|..|..:    ....||..:|...::|||.||         :.|.    
  Fly    64 TRIVNGKRIPCTEAPFQGSLHYE----GYFVCGCVIINKIWILTAHHC---------FFGPPEKY 115

  Fly   136 TVFADVEDSVEELQVTHRDFII----YPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMH 196
            ||....:......|:.|...|:    |.||.   ...|||:::|...|...:.|:|::|...   
  Fly   116 TVRVGSDQQRRGGQLRHVKKIVALAAYNDYT---MRHDLAMMKLKSPVYFGKCVRPVKLPST--- 174

  Fly   197 QNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC-ICYFLPGLVSQRRHLCTDGSNGR 260
            :.....|...:||||....:.....|.|:.:..:.|.:.:| ..|...||...:..:|...:| :
  Fly   175 KTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTN-K 238

  Fly   261 GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            .:|:||||||:..  |.|.|  |:.|:|.  || ....|.||.....|:|||::
  Fly   239 DSCSGDSGGPLTS--RGVLY--GIVSWGI--GCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 65/244 (27%)
Tryp_SPc 77..314 CDD:238113 66/247 (27%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 65/244 (27%)
Tryp_SPc 66..287 CDD:238113 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.