DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Tmprss9

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:255 Identity:83/255 - (32%)
Similarity:117/255 - (45%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT---DAIAAKIYTGAT 136
            |||.||..|:.|.:|:||.|.::....   :||..|:..:::|:||||..   |.:....:.|..
  Rat   862 TRIVGGSAASLGEWPWQVSLWLRRREH---RCGAVLVAERWLLSAAHCFDVYGDPMQWAAFLGTP 923

  Fly   137 VFADVEDSVEELQVTHRD--FIIYP-DYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198
            ..:..|..:|.:...:|.  :.||. ||       |:||:.|...||.|..|:||.|.|......
  Rat   924 FLSSTEGQLERVARIYRHPFYNIYTLDY-------DVALLELAGPVRRSRLVRPICLPGPTRPPE 981

  Fly   199 FLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTD-GSNGRGA 262
               |....::|||.|.:. ....|.||.....|:.::.| ..|.|..:|.|. ||.. ...|..:
  Rat   982 ---GARCVITGWGSLREG-GSMARQLQKAAVRVLSEQTC-RRFYPVQISSRM-LCAGFPQGGVDS 1040

  Fly   263 CNGDSGGPVVY-----HWRNVSYLIGVTSFGSAEGCEVGG----PTVYTRITAYLPWIRQ 313
            |:||:|||:..     .|    .|.||||:|  .||   |    |.||||:.|.|.||.|
  Rat  1041 CSGDAGGPLACREPSGQW----VLTGVTSWG--YGC---GRPHFPGVYTRVAAVLGWIGQ 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 79/250 (32%)
Tryp_SPc 77..314 CDD:238113 81/253 (32%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.