DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss30

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:254 Identity:85/254 - (33%)
Similarity:121/254 - (47%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIY---TGATV 137
            :|.||:.|..|.:|:||.|.|...|.   .||||||...:|||||||...::....|   .|...
Mouse    73 KIVGGQDALEGQWPWQVSLWITEDGH---ICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLT 134

  Fly   138 FADVEDSVEELQVTHRDFIIYPDYLGFGGYS-DLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV 201
            .:.:|.  ....|..|:..::|.||.....| |:||::|...:|.| |..|:.|...   |..|.
Mouse   135 LSLLEP--HSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPS-QFTPVCLPAA---QTPLT 193

  Fly   202 -GKVVTLSGWGYLGDSTDKR--TRLLQYLDAEVIDQERC-ICYFLPG------LVSQRRHLCTDG 256
             |.|..::|||    :|.:|  ..:||.|...::|.|.| ..|...|      .:.|...||...
Mouse   194 PGTVCWVTGWG----ATQERDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGY 254

  Fly   257 SNG-RGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            ..| :.:|.||||||:|....:....:|:||:|.  || ....|.||||:..|:.||::
Mouse   255 VEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI--GCARPYRPGVYTRVPTYVDWIQR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/250 (33%)
Tryp_SPc 77..314 CDD:238113 85/253 (34%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.