DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and HABP2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:318 Identity:85/318 - (26%)
Similarity:131/318 - (41%) Gaps:91/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQV----GLV 95
            ||:|.:....:.     |:::    |.|.|:...:.    .||.||..:|.|..|:|.    .|.
Human   285 EESPTEPSTKLP-----GFDS----CGKTEIAERKI----KRIYGGFKSTAGKHPWQASLQSSLP 336

  Fly    96 IQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEE-----------LQ 149
            :.:|......|||:||...:||||||| ||.....:   ..|..|.:...||           .:
Human   337 LTISMPQGHFCGGALIHPCWVLTAAHC-TDIKTRHL---KVVLGDQDLKKEEFHEQSFRVEKIFK 397

  Fly   150 VTH---RDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE----LAGEFMHQ------NFLV 201
            .:|   ||.|         .::|:||::|          :|::    |..:::..      :|..
Human   398 YSHYNERDEI---------PHNDIALLKL----------KPVDGHCALESKYVKTVCLPDGSFPS 443

  Fly   202 GKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRR---HLCTDG------- 256
            |....:||||.  ..|.|.:|  |.|||:|......:|       :.|:   |:..|.       
Human   444 GSECHISGWGV--TETGKGSR--QLLDAKVKLIANTLC-------NSRQLYDHMIDDSMICAGNL 497

  Fly   257 -SNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVG-GPTVYTRITAYLPWIR 312
             ..|:..|.||||||:........|:.|:.|:    |.|.| .|.|||::|.:|.||:
Human   498 QKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSW----GLECGKRPGVYTQVTKFLNWIK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 76/274 (28%)
Tryp_SPc 77..314 CDD:238113 77/276 (28%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 77/276 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.