DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:242 Identity:70/242 - (28%)
Similarity:111/242 - (45%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADV 141
            |.||..:.....||...|.|.......|.|||.||:.|||||||||....|.  :..||......
  Rat    21 IIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHCKGREIT--VILGAHDVRKR 83

  Fly   142 EDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQ--PIELAGEFMHQNFLVGKV 204
            |.:.::::|..:  ||:..|.......|:.|::|.:||..:..|.  |:....:|:|.    |.:
  Rat    84 ESTQQKIKVEKQ--IIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLPSPSDFIHP----GAM 142

  Fly   205 VTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG-SNGRGACNGDSG 268
            ...:|||..| ..|..:..|:.::..::|::.|:.|   .....:..:|... :..|.|..||||
  Rat   143 CWAAGWGKTG-VRDPTSYTLREVELRIMDEKACVDY---RYYEYKFQVCVGSPTTLRAAFMGDSG 203

  Fly   269 GPV----VYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311
            ||:    |.|        |:.|:|..   :...|.::||::.|:|||
  Rat   204 GPLLCAGVAH--------GIVSYGHP---DAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 68/240 (28%)
Tryp_SPc 77..314 CDD:238113 70/242 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 68/240 (28%)
Tryp_SPc 21..242 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.