DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and F10

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:302 Identity:86/302 - (28%)
Similarity:142/302 - (47%) Gaps:43/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSEPWLDTFEHPKEETPDDDDAIM---ERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELA 83
            :|||      .|::..||.|  |:   |...:|      |...|.|.|.|....:  ||.||:..
  Rat   190 NSEP------DPEDLMPDAD--ILYPTESPSEL------LNLNKTEPEANSDDVI--RIVGGQEC 238

  Fly    84 TRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVE-- 146
            .||..|:| .|:......|.. |||:::...::|||||||..|...|:..| .:..:.||..|  
  Rat   239 KRGECPWQ-ALLFSDEETDGF-CGGTILNEFYILTAAHCLHQAKRFKVRVG-DLNTEQEDGGEMV 300

  Fly   147 ---ELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL-AGEFMHQNFLVGKVVTL 207
               ::.:.|..|  ..|...|    |:|::||...:...|.|.|..| ..::.....:..|...:
  Rat   301 HEVDMIIKHNKF--QRDTYDF----DIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIV 359

  Fly   208 SGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGR--GACNGDSGGP 270
            ||:|...:. .:::::|:.::...:|:..|   .|....|..:::...|.:.:  .||.||||||
  Rat   360 SGFGRTHEK-GRQSKVLKMMEVPYVDRNTC---RLSTSFSITQNMFCAGYDAKQEDACQGDSGGP 420

  Fly   271 VVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            .|..:::..::.|:.|:|  ||| ..|...:||::||:|.||
  Rat   421 HVTRFKDTYFVTGIVSWG--EGCARKGKYGIYTKVTAFLKWI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/243 (28%)
Tryp_SPc 77..314 CDD:238113 70/244 (29%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 70/244 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.