DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:261 Identity:75/261 - (28%)
Similarity:114/261 - (43%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIY 132
            ::|.....||.||.....|.:|:|..|  |..|:.  :||.:||...::::||||.|.......:
Human   183 SKTLGQSLRIVGGTEVEEGEWPWQASL--QWDGSH--RCGATLINATWLVSAAHCFTTYKNPARW 243

  Fly   133 T---GATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEF 194
            |   |.|:      ...:::...|..|::..|.......|::|..|...|..:..|..:.|..  
Human   244 TASFGVTI------KPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPD-- 300

  Fly   195 MHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC---ICY---FLPGLVSQRRHLC 253
            ....|..|.|:.::|:|.|.:....:..|.| ....:||...|   ..|   ..|      |.||
Human   301 ASYEFQPGDVMFVTGFGALKNDGYSQNHLRQ-AQVTLIDATTCNEPQAYNDAITP------RMLC 358

  Fly   254 TDGSNGR-GACNGDSGGPVV-YHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTA 316
            .....|: .||.||||||:| ...|::.||.|:.|:|. |..:...|.||||:||...||..:|.
Human   359 AGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGD-ECAKPNKPGVYTRVTALRDWITSKTG 422

  Fly   317 M 317
            :
Human   423 I 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/245 (29%)
Tryp_SPc 77..314 CDD:238113 72/247 (29%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.