DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss34

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:277 Identity:83/277 - (29%)
Similarity:124/277 - (44%) Gaps:76/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IAGGELATRGMFPYQVGL---VIQLSGADLVKCGGSLITLQFVLTAAHCL----TDAIAAKIYTG 134
            |.||...:...||:||.|   .::||..:.: ||||||..|:|||||||:    .:|...::..|
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHI-CGGSLIHPQWVLTAAHCVELKEMEASCFRVQVG 96

  Fly   135 ATVFADVEDSVEELQVTHRD-------FIIYPDY---LGFGGYSDLALIRLPRKVRTSEQVQPIE 189
                        :|::...|       .|.:|.:   |...|.:|:||::|...|..||:|.|:.
  Rat    97 ------------QLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVS 149

  Fly   190 LAGEFMHQNFLVGKVVTLSGWGYL--------------------GDS-TDKRTRLLQYLD--AEV 231
            |..  ..|.....|...::|||.:                    |:| .:::.|....||  .::
  Rat   150 LPA--ASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKI 212

  Fly   232 IDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYL-IGVTSFGSAEGCEV 295
            |..:.               ||. |..||.:|..|||||:|..| |.|:: :||.|:|.  ||.:
  Rat   213 IKDDM---------------LCA-GMEGRDSCQADSGGPLVCRW-NCSWVQVGVVSWGI--GCGL 258

  Fly   296 GG-PTVYTRITAYLPWI 311
            .. |.||||:.:||.||
  Rat   259 PDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 81/275 (29%)
Tryp_SPc 77..314 CDD:238113 83/277 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 83/277 (30%)
Tryp_SPc 33..275 CDD:214473 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.