DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss29

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:258 Identity:91/258 - (35%)
Similarity:135/258 - (52%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IAGGELATRGMFPYQVGL-VIQLSGADLVK-CGGSLITLQFVLTAAHCL----TDAIAAKIYTGA 135
            |.||..|.:|.:|:||.| |.:.:.|..|. ||||:|..|:|||||||:    .|..|.:||.|.
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQ 95

  Fly   136 TVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFL 200
            ......|..::..:|     ||:||::..|..||:||::|.:.||:...|:|::|:...:.    
  Rat    96 VYLYGGEKLLKVSRV-----IIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLE---- 151

  Fly   201 VGK--VVTLSGWGYLG--DSTDKRTRLLQYLDAEVIDQERCICYFLPG---------LVSQRRHL 252
            |.|  |..::|||.:.  :|.....| ||.:..:::|...|...:...         |:.|.. |
  Rat   152 VTKKDVCWVTGWGSVSMHESLPPPYR-LQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDM-L 214

  Fly   253 CTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGG-PTVYTRITAYLPWIRQQ 314
            |. ||:||.:|.||||||:|.:......|:||.|:|  .||.:.. |.||.|:..:||||..|
  Rat   215 CA-GSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWG--YGCALKDIPGVYARVQFFLPWITGQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 88/253 (35%)
Tryp_SPc 77..314 CDD:238113 90/256 (35%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.