DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss27

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:256 Identity:82/256 - (32%)
Similarity:118/256 - (46%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIY---TGATV 137
            |:.|||.|..|.:|:||.  ||.:||..  ||||||...:|||||||.::.....||   .||..
  Rat    37 RMVGGEDALEGEWPWQVS--IQRNGAHF--CGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGALK 97

  Fly   138 FADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVG 202
            ..  :.....|.|..:....:|:|.|....:|:||:.|...|..::.:.|:.|....:  .|..|
  Rat    98 LQ--QPGPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLPDPSV--VFKSG 158

  Fly   203 KVVTLSGWGYLGDSTDK--RTRLLQYLDAEVIDQERCICYFLPGLVSQRR-------HLCTDGSN 258
            ....::|||...:. |:  ..|:||.|...:||..:|...:.....:..:       .||...:.
  Rat   159 MNCWVTGWGSPSEQ-DRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAE 222

  Fly   259 G-RGACNGDSGGPVV----YHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            | :.||.||||||:|    ..|...    ||.|:|  ||| ....|.||.|:.::..||.|
  Rat   223 GKKDACKGDSGGPLVCLVDQSWVQA----GVISWG--EGCARRNRPGVYIRVASHYQWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 79/252 (31%)
Tryp_SPc 77..314 CDD:238113 81/255 (32%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 79/252 (31%)
Tryp_SPc 39..278 CDD:238113 81/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.