DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:318 Identity:89/318 - (27%)
Similarity:144/318 - (45%) Gaps:23/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLSSTLVKSSEPWLDTFEHPKEET--PDDDDAIMERRWQLGYENFRLRCE-KFEMEGNQTAAV 73
            ||.::...|.||..:.|.:.......  |..:.|...::.:...:..|.|.| ....|...||.:
Human     5 LLSVALLFVGSSHLYSDHYSPSGRHRLGPSPEPAASSQQAEAVRKRLRRRREGGAHAEDCGTAPL 69

  Fly    74 R-----TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYT 133
            :     :||.||..|..|.:|:.|.|.|:.....:..|||:|:..::|||||||..||....::|
Human    70 KDVLQGSRIIGGTEAQAGAWPWVVSLQIKYGRVLVHVCGGTLVRERWVLTAAHCTKDASDPLMWT 134

  Fly   134 GATVFADVEDSVEEL-QVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQ 197
            ......::....... ::..:..||:|:::.....:|:||..|.:.||.::.:|||.|..:..  
Human   135 AVIGTNNIHGRYPHTKKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYIQPICLPFDVF-- 197

  Fly   198 NFLVGKV-VTLSGWGYLGDSTDKRTRLLQYLDAEV--IDQERCICYFLPGLVSQRRHLCTDGSNG 259
            ..|.|.. ..:||||...:. ...|.:||  ||||  |.:|.|......|.:......|....:|
Human   198 QILDGNTKCFISGWGRTKEE-GNATNILQ--DAEVHYISREMCNSERSYGGIIPNTSFCAGDEDG 259

  Fly   260 R-GACNGDSGGPVVYHWRNVS--YLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            . ..|.||||||::.:.....  :::|:||:|  .|| ..|.|.||...:.|..|:.:
Human   260 AFDTCRGDSGGPLMCYLPEYKRFFVMGITSYG--HGCGRRGFPGVYIGPSFYQKWLTE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/242 (31%)
Tryp_SPc 77..314 CDD:238113 74/245 (30%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 5/38 (13%)
Tryp_SPc 78..316 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.