DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and mst1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_694512.1 Gene:mst1 / 259260 ZFINID:ZDB-GENE-020806-3 Length:709 Species:Danio rerio


Alignment Length:314 Identity:85/314 - (27%)
Similarity:131/314 - (41%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PWLDTFEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTA------AVRTRIAGGELA 83
            ||..|.: ||.|.  |..||.    |...|...:.....|:|.|:..      ..|.||.||   
Zfish   431 PWCYTSD-PKTEF--DYCAIK----QCAGEKVPIIGPTTEVEFNECGKREDRLRSRLRIVGG--- 485

  Fly    84 TRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDA-IAAKIYTG--ATVFADVEDSV 145
            |.|..|:.|.| ....|...  |||||::.::|::...|.:.. :....||.  .|:|.|.::..
Zfish   486 TPGNSPWTVSL-RDRKGNHF--CGGSLVSSEWVISTKQCFSSCYVDLTGYTAMMGTLFRDPKEGE 547

  Fly   146 EELQ-VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV--GKVVTL 207
            .:|| ::....:..|      ..|.|.:::|....:.:|:|..|.|..|    .::|  |.:..:
Zfish   548 PDLQRISLTKIVCGP------SESHLVMLQLETPAQFNERVSQICLPPE----RYIVPDGTICEI 602

  Fly   208 SGWGYL---GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG-SNGRGACNGDSG 268
            :|||..   ||.|     :|......|:..:.|..|| .|.| :...:||.. ..|.|||..|.|
Zfish   603 AGWGETKGKGDET-----VLNVAQMPVLSNKDCNQYF-KGRV-RENEMCTMAFQAGVGACERDYG 660

  Fly   269 GPVVYH----WRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318
            ||:...    |.....:|.:...|.|     |.|.::.|::.|:.||::...||
Zfish   661 GPLACQNSDCWVLEGVIIPMRRCGHA-----GQPNIFIRVSVYVDWIKKVMEMT 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 66/248 (27%)
Tryp_SPc 77..314 CDD:238113 67/250 (27%)
mst1NP_694512.1 PAN_AP_HGF 24..105 CDD:238532
KR 109..187 CDD:238056
KR 192..271 CDD:214527
KR 284..365 CDD:214527
KR 370..451 CDD:238056 10/26 (38%)
Tryp_SPc 481..702 CDD:214473 66/248 (27%)
Tryp_SPc 482..705 CDD:238113 67/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.