DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TPSG1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:279 Identity:89/279 - (31%)
Similarity:127/279 - (45%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTA 119
            :|.|.|.:     .|.:....||.||..|..|.:|:|..|.::    .:..|||||::.|:||||
Human    46 SFDLGCGR-----PQVSDAGGRIVGGHAAPAGAWPWQASLRLR----RVHVCGGSLLSPQWVLTA 101

  Fly   120 AHCLTDAIAAKIYTGATVFADVEDSVEELQVT---H----RDFIIYPDYLGFGGYS-DLALIRLP 176
            |||         ::|:...:|.:..:.||::|   |    |..|::....|..|.| |:||:.|.
Human   102 AHC---------FSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELS 157

  Fly   177 RKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTR---------LLQYLDAEVI 232
            ..|..|.::.|:.|..  ...:|..|....::||||        ||         .|:.:...|:
Human   158 VPVTLSSRILPVCLPE--ASDDFCPGIRCWVTGWGY--------TREGEPLPPPYSLREVKVSVV 212

  Fly   233 DQERC-ICYFLP-GLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-E 294
            |.|.| ..|..| |.:.|...||..|..  .||..|||||:|..........|..|:|  ||| .
Human   213 DTETCRRDYPGPGGSILQPDMLCARGPG--DACQDDSGGPLVCQVNGAWVQAGTVSWG--EGCGR 273

  Fly   295 VGGPTVYTRITAYLPWIRQ 313
            ...|.||||:.||:.|||:
Human   274 PNRPGVYTRVPAYVNWIRR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 82/254 (32%)
Tryp_SPc 77..314 CDD:238113 84/257 (33%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 82/254 (32%)
Tryp_SPc 63..293 CDD:238113 84/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.