DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Plat

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_037283.2 Gene:Plat / 25692 RGDID:3342 Length:559 Species:Rattus norvegicus


Alignment Length:366 Identity:89/366 - (24%)
Similarity:137/366 - (37%) Gaps:89/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQATSAFFLLLLSSTLVKSSEPW-------------------LDTFEHPKEETPDDDDAIMERRW 49
            |:.|.:|      :|...|..||                   |....|.....||.|    .:.|
  Rat   221 YRGTHSF------TTSKASCLPWNSMILIGKTYTAWRANSQALGLGRHNYCRNPDGD----AKPW 275

  Fly    50 QLGYENFRLRCEKFEMEGNQTAAVRT------RIAGGELATRGMFPYQVGLVI--QLSGADLVKC 106
            ....::.:|..|..:|....|..:|.      ||.||........|:|..:.:  :.|..:...|
  Rat   276 CHVMKDRKLTWEYCDMSPCSTCGLRQYKQPQFRIKGGLFTDITSHPWQAAIFVKNKRSPGERFLC 340

  Fly   107 GGSLITLQFVLTAAHCLTDAIA---AKIYTGAT---VFADVEDSVE-ELQVTHRDF--IIYPDYL 162
            ||.||:..:||:||||..:...   .|:..|.|   |..:.|.:.| |..:.|::|  ..|.   
  Rat   341 GGVLISSCWVLSAAHCFVERFPPHHLKVVLGRTYRVVPGEEEQTFEIEKYIVHKEFDDDTYD--- 402

  Fly   163 GFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKV--------------VTLSGWGYL 213
                 :|:||::|  :..:|:..|          ::..||..              ..|||:|..
  Rat   403 -----NDIALLQL--RSDSSQCAQ----------ESSSVGTACLPDPDVQLPDWTECELSGYGKH 450

  Fly   214 GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRG------ACNGDSGGPVV 272
            ..|:...:..|:.....:....||....|.........||...:...|      ||.||||||:|
  Rat   451 EASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTITSNMLCAGDTRTGGNQDVHDACQGDSGGPLV 515

  Fly   273 YHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIR 312
            ........|:|:.|:|.  || :...|.:||::|.||.||:
  Rat   516 CMIDKRMTLLGIISWGL--GCGQKDVPGIYTKVTNYLNWIQ 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/266 (26%)
Tryp_SPc 77..314 CDD:238113 70/268 (26%)
PlatNP_037283.2 Important for binding to annexin A2. /evidence=ECO:0000250 39..49
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 16/83 (19%)
Tryp_SPc 311..556 CDD:238113 69/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.