DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Plau

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:329 Identity:86/329 - (26%)
Similarity:138/329 - (41%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EHPKEETPDDDDAIMERRW---QLGYENFRLRC-----------------EKFEMEGNQTAAVRT 75
            :|.....||:    ..|.|   |:|.:.|...|                 :.|:. |.:....|.
  Rat   118 KHNYCRNPDN----QRRPWCYVQIGLKQFVQECMVQDCSLSKKPSSTVDQQGFQC-GQKALRPRF 177

  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGAD--LVKCGGSLITLQFVLTAAHCLTDAIAAK---IYTGA 135
            :|.|||.......|:...:.::..|..  ..|||||||:..:|.:|.||..:....:   :|.|.
  Rat   178 KIVGGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQ 242

  Fly   136 TVF-----ADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRT--------SEQVQP 187
            :..     .:::..||:| :.|.||  ..:.|.|  ::|:||:    |:||        |..:|.
  Rat   243 SKRNSYNPGEMKFEVEQL-ILHEDF--SDETLAF--HNDIALL----KIRTSTGQCAQPSRTIQT 298

  Fly   188 IELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHL 252
            |.|...|....|  |....::|:|....:.....:.|:....::|..|:|......|.....:.|
  Rat   299 ICLPPRFGDAPF--GSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQCKQPHYYGSEINYKML 361

  Fly   253 C-TDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQT 315
            | .|......:|:||||||::.:......|.|:.|:||  || |...|.||||::.:|.||:...
  Rat   362 CAADPEWKTDSCSGDSGGPLICNIDGRPTLSGIVSWGS--GCAEKNKPGVYTRVSYFLNWIQSHI 424

  Fly   316 AMTN 319
            ...|
  Rat   425 GEEN 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/254 (28%)
Tryp_SPc 77..314 CDD:238113 73/256 (29%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056 9/37 (24%)
Connecting peptide 152..178 3/26 (12%)
Tryp_SPc 178..420 CDD:214473 71/254 (28%)
Tryp_SPc 179..423 CDD:238113 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.