DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Mst1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:307 Identity:81/307 - (26%)
Similarity:130/307 - (42%) Gaps:45/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSEPWLDT------FEHPKEETPDDDD--AIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIA 78
            |..||..|      |::...:..|||.  :|::...|:.:|    :|.|...:.|     |.|:.
  Rat   466 SHGPWCYTLDPETLFDYCALKRCDDDQPPSILDPPVQVQFE----KCGKRVDQSN-----RLRVV 521

  Fly    79 GGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL---TDAIAA-KIYTGATVFA 139
            ||.   .|..|:.|.| ....|...  |||||:..|:||||..|:   .|.:.. :::.| |:..
  Rat   522 GGH---PGNSPWTVSL-RNRQGQHF--CGGSLVKEQWVLTARQCIWSCHDPLTGYEVWLG-TINQ 579

  Fly   140 DVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV--G 202
            :.:.....||...    :.....|..| |.|.|::|.|.|..:..|..|.|..|    .::|  |
  Rat   580 NPQPGEANLQRVS----VAKTVCGPAG-SQLVLLKLERPVILNHHVARICLPPE----QYVVPPG 635

  Fly   203 KVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNG-RGACNGD 266
            ....::|||. ...|...| :|.....:||..:.|...:...:  |...:||:|... .|||.||
  Rat   636 TNCEIAGWGE-SKGTSNST-VLHVAKMKVISSQECNVKYRRRV--QESEICTEGLLAPTGACEGD 696

  Fly   267 SGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313
            .|||:..:..:...|.|:. ..:........|.::||::.::.||.:
  Rat   697 YGGPLACYTHDCWVLQGLI-IPNRVCARPRWPAIFTRVSVFVDWINK 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 64/241 (27%)
Tryp_SPc 77..314 CDD:238113 65/244 (27%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527 5/23 (22%)
Tryp_SPc 520..743 CDD:238113 65/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.