DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and F10

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:262 Identity:76/262 - (29%)
Similarity:126/262 - (48%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MEGNQTAAVR-----TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT 124
            ::.|||...|     |||.||:....|..|:|..|:.:.:..   .|||::::..::|||||||.
Human   218 LDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEG---FCGGTILSEFYILTAAHCLY 279

  Fly   125 DAIAAKIYTG--ATVFADVEDSVEELQVT--HRDFI--IYPDYLGFGGYSDLALIRLPRKVRTSE 183
            .|...|:..|  .|...:..::|.|::|.  |..|.  .| |:       |:|::||...:....
Human   280 QAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETY-DF-------DIAVLRLKTPITFRM 336

  Fly   184 QVQPIEL-AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC--ICYFLPGL 245
            .|.|..| ..::.....:..|...:||:|...:...:.|| |:.|:...:|:..|  ...|   :
Human   337 NVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTR-LKMLEVPYVDRNSCKLSSSF---I 397

  Fly   246 VSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLP 309
            ::|........:....||.||||||.|..:::..::.|:.|:|  ||| ..|...:||::||:|.
Human   398 ITQNMFCAGYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWG--EGCARKGKYGIYTKVTAFLK 460

  Fly   310 WI 311
            ||
Human   461 WI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/244 (28%)
Tryp_SPc 77..314 CDD:238113 70/245 (29%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 70/245 (29%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.