DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and F9

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:264 Identity:83/264 - (31%)
Similarity:128/264 - (48%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFA 139
            ||:.|||.|..|.||:||    .|:|.....||||::..::::|||||:...:...:..|     
Human   225 TRVVGGEDAKPGQFPWQV----VLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG----- 280

  Fly   140 DVEDSVEELQVTH--RDFI-IYPDY---LGFGGYS-DLALIRLPRKVRTSEQVQPIELAGEFMHQ 197
              |.::||.:.|.  |:.| |.|.:   .....|: |:||:.|...:..:..|.||.:|.:....
Human   281 --EHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTN 343

  Fly   198 NFLVGKVVTLSGWG---YLGDSTDKRTRLLQYLDAEVIDQERCI------CY---FLPGLVSQRR 250
            .||......:||||   :.|.|    ..:||||...::|:..|:      .|   |..|.     
Human   344 IFLKFGSGYVSGWGRVFHKGRS----ALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGF----- 399

  Fly   251 HLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGP-TVYTRITAYLPWIRQQ 314
            |     ..||.:|.||||||.|......|:|.|:.|:|  |.|.:.|. .:||:::.|:.||:::
Human   400 H-----EGGRDSCQGDSGGPHVTEVEGTSFLTGIISWG--EECAMKGKYGIYTKVSRYVNWIKEK 457

  Fly   315 TAMT 318
            |.:|
Human   458 TKLT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/254 (31%)
Tryp_SPc 77..314 CDD:238113 79/256 (31%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 79/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.