DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CELA1

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:196 Identity:51/196 - (26%)
Similarity:73/196 - (37%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PNRSRS--FNSKKVSPKVPSGSYNIAQVTYELN--LLGTRG--PRRMNCIMHSIPSLALEPGGTV 210
            ||..||  |..:.:...:..||..:..:...|.  |.|.|.  ||........:.:|...|..|.
Human   659 PNTKRSPYFQGQHLQHLLKVGSVELEAIIMGLEDVLYGVRANFPRLFFLSDSELVALLASPLDTS 723

  Fly   211 PSQPEFLQRSLD----ESFRSIGSSKIVNHSGDFTRPKE------------EEGKVR-PLVLKTK 258
            .::| :.||...    .:|||..::| .|:..|.....|            ||.|:: ||.|...
Human   724 EAKP-WAQRCFPYIKAVNFRSKSTNK-ENNDKDSKSSIETVETISVLGACGEEVKLQEPLPLYPD 786

  Fly   259 PPRWLQPLRCWCLNFKGRVTVASVKNFQLMSAATVQPGSGSDGGALATRPSL------SPQQPEQ 317
            .|:||..|.. ||    |:.|.::    |.|....:         ||..|||      .|||.:.
Human   787 LPKWLASLET-CL----RLVVVNL----LQSCVATR---------LAQGPSLIKALKAMPQQRQM 833

  Fly   318 S 318
            |
Human   834 S 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 48/190 (25%)
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.