DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss8

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:267 Identity:85/267 - (31%)
Similarity:126/267 - (47%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAK 130
            |.:..|.::.||.||..|..|.:|:||.  |..:|..:  |||||::.|:|::||||.....:.:
  Rat    34 EASCGAVIQPRITGGGSAKPGQWPWQVS--ITYNGVHV--CGGSLVSNQWVVSAAHCFPREHSKE 94

  Fly   131 IYTGATVFADVEDSVEELQVTHRDFII--------YPDYLGFGGYSDLALIRLPRKVRTSEQVQP 187
            .|       :|:....:|.....|.::        :..|...|...|:|||||...|..|..::|
  Rat    95 EY-------EVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRP 152

  Fly   188 IELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRT-RLLQYLDAEVIDQERCICYFLPGLVSQRRH 251
            |.|..  .:.:|..|...|::|||::..|...:| |.||.|:..:|.:|.|.|.:....|.:..|
  Rat   153 ICLPA--ANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPH 215

  Fly   252 ------LCTD-GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLP 309
                  ||.. ...|:.||.||||||:......:.||.|:.|:|.|.|.. ..|.|||..:.|..
  Rat   216 TIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAP-NRPGVYTLTSTYAS 279

  Fly   310 WIRQQTA 316
            ||....|
  Rat   280 WIHHHVA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 80/250 (32%)
Tryp_SPc 77..314 CDD:238113 81/252 (32%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 80/250 (32%)
Tryp_SPc 45..284 CDD:238113 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.