DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Plat

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:338 Identity:83/338 - (24%)
Similarity:132/338 - (39%) Gaps:56/338 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAFFLLLLSSTLVKSSEPWLDTFEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAA 72
            ::..|:..|.|..:::...|....|.....||.|    .|.|....::.:|..|..:|....|..
Mouse   238 NSIVLMGKSYTAWRTNSQALGLGRHNYCRNPDGD----ARPWCHVMKDRKLTWEYCDMSPCSTCG 298

  Fly    73 VRT------RIAGGELATRGMFPYQVGLVI--QLSGADLVKCGGSLITLQFVLTAAHCLTDAIA- 128
            :|.      ||.||........|:|..:.:  :.|..:...|||.||:..:||:||||..:... 
Mouse   299 LRQYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLERFPP 363

  Fly   129 --AKIYTGAT--VFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE 189
              .|:..|.|  |....|:...|::    .:|::.::......:|:||::|..:.:...|     
Mouse   364 NHLKVVLGRTYRVVPGEEEQTFEIE----KYIVHEEFDDDTYDNDIALLQLRSQSKQCAQ----- 419

  Fly   190 LAGEFMHQNFLVGKV--------------VTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICY 240
                   ::..||..              ..|||:|....|:...:..|:.....:....||...
Mouse   420 -------ESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQ 477

  Fly   241 FLPGLVSQRRHLCTDGSNGRG------ACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGP 298
            .|.........||...:...|      ||.||||||:|........|.|:.|:|.  || :...|
Mouse   478 HLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGL--GCGQKDVP 540

  Fly   299 TVYTRITAYLPWI 311
            .|||::|.||.||
Mouse   541 GVYTKVTNYLDWI 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 66/262 (25%)
Tryp_SPc 77..314 CDD:238113 67/263 (25%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 13/60 (22%)
Tryp_SPc 311..556 CDD:238113 66/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.