DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:288 Identity:84/288 - (29%)
Similarity:127/288 - (44%) Gaps:81/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL-TDAIAAKIYTGATVF 138
            :||.||.:::.|.:|:|..|  |:.|..:  |||:||..::|:|||||. .|::|:.:..  |||
Human   566 SRIVGGAVSSEGEWPWQASL--QVRGRHI--CGGALIADRWVITAAHCFQEDSMASTVLW--TVF 624

  Fly   139 -----------ADVEDSVEELQVTHRDFIIYP-------DYLGFGGYSDLALIRLPRKVRTSEQV 185
                       .:|...|..|       :::|       ||       |:||::|...|..|..|
Human   625 LGKVWQNSRWPGEVSFKVSRL-------LLHPYHEEDSHDY-------DVALLQLDHPVVRSAAV 675

  Fly   186 QPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKR---------------------TRLLQYLDA 229
            :|:.|...  ...|..|....::|||.|.:...:.                     :..||.:|.
Human   676 RPVCLPAR--SHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDV 738

  Fly   230 EVIDQERCICYFLPGLVSQRRHLCTDGSNG-RGACNGDSGGPVVY-----HWRNVSYLIGVTSFG 288
            ::|.|:.|...:...:..  |.||.....| :.||.||||||:|.     .|    :|.|:.|:|
Human   739 QLIPQDLCSEVYRYQVTP--RMLCAGYRKGKKDACQGDSGGPLVCKALSGRW----FLAGLVSWG 797

  Fly   289 SAEGCEVGGPT---VYTRITAYLPWIRQ 313
            .  ||  |.|.   ||||||..:.||:|
Human   798 L--GC--GRPNYFGVYTRITGVISWIQQ 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 81/283 (29%)
Tryp_SPc 77..314 CDD:238113 83/286 (29%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 83/286 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.