DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Mst1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:308 Identity:79/308 - (25%)
Similarity:128/308 - (41%) Gaps:47/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSEPWLDT------FEHPKEETPDDDD--AIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIA 78
            |..||..|      |::...:..|||.  :|::...|:.:|    :|.|...:.|     :.|:.
Mouse   435 SHGPWCYTLDPDILFDYCALQRCDDDQPPSILDPPDQVVFE----KCGKRVDKSN-----KLRVV 490

  Fly    79 GGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDA----IAAKIYTGATVFA 139
            ||.   .|..|:.|.| ....|...  |||||:..|:||||..|:...    ...:::.| |:..
Mouse   491 GGH---PGNSPWTVSL-RNRQGQHF--CGGSLVKEQWVLTARQCIWSCHEPLTGYEVWLG-TINQ 548

  Fly   140 DVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV--G 202
            :.:.....||...    :.....|..| |.|.|::|.|.|..:..|..|.|..|    .::|  |
Mouse   549 NPQPGEANLQRVP----VAKAVCGPAG-SQLVLLKLERPVILNHHVALICLPPE----QYVVPPG 604

  Fly   203 KVVTLSGWG-YLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG-SNGRGACNG 265
            ....::||| .:|.|.:   .:|......||..:.|...:...:  |...:||.| ....|||.|
Mouse   605 TKCEIAGWGESIGTSNN---TVLHVASMNVISNQECNTKYRGHI--QESEICTQGLVVPVGACEG 664

  Fly   266 DSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313
            |.|||:..:..:...|.|:. ..:........|.::||::.::.||.:
Mouse   665 DYGGPLACYTHDCWVLQGLI-IPNRVCARPRWPAIFTRVSVFVDWINK 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 63/242 (26%)
Tryp_SPc 77..314 CDD:238113 64/245 (26%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527 5/23 (22%)
Tryp_SPc 488..709 CDD:214473 63/242 (26%)
Tryp_SPc 489..712 CDD:238113 64/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.