DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CTRL

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:242 Identity:75/242 - (30%)
Similarity:115/242 - (47%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFAD 140
            ||..||.|..|.:|:||.|. ..||...  ||||||:..:|:|||||........:..|.   .|
Human    33 RIVNGENAVLGSWPWQVSLQ-DSSGFHF--CGGSLISQSWVVTAAHCNVSPGRHFVVLGE---YD 91

  Fly   141 VEDSVEELQV-THRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKV 204
            ...:.|.||| :....|.:|.:......:|:.|::|....:.:.::.|:.||..  ::....|..
Human    92 RSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASS--NEALTEGLT 154

  Fly   205 VTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGG 269
            ...:|||.|....:.....||.:...::...:|..|:...:....  :|..|: |..:|.|||||
Human   155 CVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSM--ICAGGA-GASSCQGDSGG 216

  Fly   270 PVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTA 316
            |:|....|...|||:.|:|: :.|.|..|.||||::.:..||.|..|
Human   217 PLVCQKGNTWVLIGIVSWGT-KNCNVRAPAVYTRVSKFSTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/235 (30%)
Tryp_SPc 77..314 CDD:238113 72/237 (30%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.