DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and F9

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:256 Identity:77/256 - (30%)
Similarity:123/256 - (48%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFA 139
            ||:.|||.|..|..|:||    .|:|.....|||::|..::::||||||......::..|.....
Mouse   235 TRVVGGENAKPGQIPWQV----ILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYNID 295

  Fly   140 DVEDSVEELQVTHRDFIIYPDY-LGFGGYS-DLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVG 202
            ..||:.:...|...  |.:..| .....|| |:||:.|.:.:..:..|.||.:|.......||..
Mouse   296 KKEDTEQRRNVIRT--IPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANREYTNIFLKF 358

  Fly   203 KVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSN--------- 258
            ....:||||.:.:. .::..:||||...::|:..|:          |....|..:|         
Mouse   359 GSGYVSGWGKVFNK-GRQASILQYLRVPLVDRATCL----------RSTTFTIYNNMFCAGYREG 412

  Fly   259 GRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGP-TVYTRITAYLPWIRQQTAMT 318
            |:.:|.||||||.|......|:|.|:.|:|  |.|.:.|. .:||:::.|:.||:::|.:|
Mouse   413 GKDSCEGDSGGPHVTEVEGTSFLTGIISWG--EECAMKGKYGIYTKVSRYVNWIKEKTKLT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 73/248 (29%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 237..467 CDD:238113 73/248 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.