DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and F10

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:288 Identity:82/288 - (28%)
Similarity:132/288 - (45%) Gaps:37/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRT-----RIAGGELATRGMFPYQVGLVIQL 98
            |.:||:::..:....||   ..|...:  |:|...|:     ||.||.....|..|:| .|:|..
Mouse   206 DLEDALLDEDFLSPTEN---PIELLNL--NETQPERSSDDLVRIVGGRECKDGECPWQ-ALLINE 264

  Fly    99 SGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTG--ATVFADVEDSVEELQVT--HRDF--II 157
            .....  |||:::...::|||||||..|...|:..|  .|...:..:.|.|:.|.  |..|  ..
Mouse   265 DNEGF--CGGTILNEFYILTAAHCLHQARRFKVRVGDRNTEKEEGNEMVHEVDVVIKHNKFQRDT 327

  Fly   158 YPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL-AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRT 221
            | ||       |:|::||...:.....|.|..| ..::.....:..|...:||:|...:. .:::
Mouse   328 Y-DY-------DIAVLRLKTPITFRMNVAPACLPQKDWAESTLMTQKTGIVSGFGRTHEK-GRQS 383

  Fly   222 RLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGR--GACNGDSGGPVVYHWRNVSYLIGV 284
            .:|:.|:...:|:..|   .|....|..:::...|...:  .||.||||||.|..::|..|:.|:
Mouse   384 NILKMLEVPYVDRNTC---KLSTSFSITQNMFCAGYEAKLEDACQGDSGGPHVTRFKNTYYVTGI 445

  Fly   285 TSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            .|:|  ||| ..|...:||::|.:|.||
Mouse   446 VSWG--EGCARKGKYGIYTKVTTFLKWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/244 (29%)
Tryp_SPc 77..314 CDD:238113 72/245 (29%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342
Tryp_SPc 243..471 CDD:214473 71/244 (29%)
Tryp_SPc 244..473 CDD:238113 72/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.