DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and LOC1277262

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_316708.5 Gene:LOC1277262 / 1277262 VectorBaseID:AGAMI1_011272 Length:329 Species:Anopheles gambiae


Alignment Length:59 Identity:15/59 - (25%)
Similarity:25/59 - (42%) Gaps:16/59 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GKLKSNFLGT--KFIVYDTAPAYNSSQILSPPNRSRSFNSKKVSPKVPSGSYNIAQVTY 179
            |.|:...:.|  |.|.||...|:       ||.....|:  :.:|::|     :.|:.|
Mosquito    18 GLLRGGAMKTEDKPIWYDVYAAF-------PPKLEPRFD--RPAPEIP-----VRQIFY 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 15/59 (25%)
LOC1277262XP_316708.5 None

Return to query results.
Submit another query.