DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and St14

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:299 Identity:88/299 - (29%)
Similarity:133/299 - (44%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQL 98
            |::..|..|   |:....|..:|               ..:.|:.||..|..|.:|:||.|....
  Rat   590 KKDCSDGSD---EKNCDCGLRSF---------------TKQARVVGGTNADEGEWPWQVSLHALG 636

  Fly    99 SGADLVKCGGSLITLQFVLTAAHCLTDAIAAKI--YTGATVFADVED-------SVEELQVTHRD 154
            .|.   .||.|||:..::::||||..|....|.  :|..|.|..:.|       .|:|.::  :.
  Rat   637 QGH---LCGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAFLGLLDQSKRSASGVQEHKL--KR 696

  Fly   155 FIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDK 219
            .|.:|.:..|....|:||:.|.:....|..|:||.|. :..|. |..||.:.::|||:..:. ..
  Rat   697 IITHPSFNDFTFDYDIALLELEKPAEYSTVVRPICLP-DNTHV-FPAGKAIWVTGWGHTKEG-GT 758

  Fly   220 RTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVS----- 279
            ...:||..:..||:|..|. ..||..::.|.......|.|..:|.||||||:    .:|.     
  Rat   759 GALILQKGEIRVINQTTCE-ELLPQQITPRMMCVGFLSGGVDSCQGDSGGPL----SSVEKDGRI 818

  Fly   280 YLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQTAM 317
            :..||.|:|  ||| :...|.|||||.....||::||.:
  Rat   819 FQAGVVSWG--EGCAQRNKPGVYTRIPEVRDWIKEQTGV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/249 (31%)
Tryp_SPc 77..314 CDD:238113 79/251 (31%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 4/14 (29%)
Tryp_SPc 615..852 CDD:238113 79/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.