DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CTRC

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:140 Identity:42/140 - (30%)
Similarity:67/140 - (47%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFAD 140
            |:.|||.|....:|:|:.|....:......|||:||...||||||||:::....::..|.... :
Human    29 RVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNTRTYRVAVGKNNL-E 92

  Fly   141 VEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGK-- 203
            |||....|.|......::..:......:|:|||:|...|..|:.:|...|.    .::.|:.|  
Human    93 VEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLP----EKDSLLPKDY 153

  Fly   204 VVTLSGWGYL 213
            ...::|||.|
Human   154 PCYVTGWGRL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 42/140 (30%)
Tryp_SPc 77..314 CDD:238113 41/139 (29%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 41/138 (30%)
Tryp_SPc 30..>173 CDD:238113 41/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.