DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and PRSS21

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:275 Identity:86/275 - (31%)
Similarity:125/275 - (45%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :.:||.|||.|..|.:|:|..|.:.    |...||.||::.::.||||||.            ..
Human    38 ITSRIVGGEDAELGRWPWQGSLRLW----DSHVCGVSLLSHRWALTAAHCF------------ET 86

  Fly   138 FADVED---------------SVEELQVTH-RDFI--IY--PDYLGFGGYSDLALIRLPRKVRTS 182
            ::|:.|               |...||..: |.|:  ||  |.|||...| |:||::|...|..:
Human    87 YSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPY-DIALVKLSAPVTYT 150

  Fly   183 EQVQPIEL-AGEFMHQNFLVGKVVTLSGWGYL-GDSTDKRTRLLQYLDAEVIDQERCICYFLPGL 245
            :.:|||.| |..|..:|   .....::||||: .|........||.:...:|:...|...||.  
Human   151 KHIQPICLQASTFEFEN---RTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLK-- 210

  Fly   246 VSQRRHLCTD------GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTR 303
            .|.|:.:..|      ...|:.||.||||||:..:...:.|.|||.|:|  .|| ....|.|||.
Human   211 YSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWG--VGCGRPNRPGVYTN 273

  Fly   304 ITAYLPWIRQQTAMT 318
            |:.:..||::..|.:
Human   274 ISHHFEWIQKLMAQS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/263 (32%)
Tryp_SPc 77..314 CDD:238113 84/265 (32%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.