DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:370 Identity:91/370 - (24%)
Similarity:152/370 - (41%) Gaps:96/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QATSAFFLLLLSS-------------TLVKSSEPWLDT------FEHPKEET---PDDDDAIMER 47
            ::.|.|.::|:|.             |..:|:|...||      :..|..:.   |...:..::.
Zfish   201 ESESTFQVVLVSDKKRSFTLMHYDYITYTQSAESGYDTNGSTVFYSIPVSDVTNLPYTSNVNVKG 265

  Fly    48 RWQLGYENFRLRCEKFEMEG-----------NQTAAV--------RTRIAGGELATRGMFPYQVG 93
            ||....:|      ..|::|           :.:|||        .....||:.::...:|:|..
Zfish   266 RWVFRVDN------SSEVKGSCINTNSQALDSPSAAVCGIIPVNSSNGTVGGQNSSAVHWPWQAS 324

  Fly    94 LVIQLSGADLVKCGGSLITLQFVLTAAHC---------LTDAIAAKI---YTGATVFADVEDSVE 146
            | ...||.   .||||||..::||:||||         ||..:..|.   |..:.:...|:..::
Zfish   325 L-YWYSGQ---TCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGPKTQNKYDPSRISRSVKAVIK 385

  Fly   147 ELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVT----- 206
                       :|.|......:|:||:||...:..::.::|:.||.|        |.|..     
Zfish   386 -----------HPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAE--------GSVFNSDTES 431

  Fly   207 -LSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG--SNGRGACNGDS 267
             ::.|..:.|... ...::.|.::..||...:|.|.:..|.::... :|. |  ..|:..|.|||
Zfish   432 WITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNM-ICA-GLLKEGKDLCQGDS 494

  Fly   268 GGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            |||:|.:..:|....|:.||||  || :...|.||||::.|..||
Zfish   495 GGPMVSNQSSVWVQSGIVSFGS--GCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 70/256 (27%)
Tryp_SPc 77..314 CDD:238113 72/257 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 13/70 (19%)
Tryp_SPc 309..537 CDD:238113 70/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.