DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and cela1.2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:254 Identity:82/254 - (32%)
Similarity:124/254 - (48%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGAT 136
            |:..|:.|||:|....:|:|:.|.....|.....|.|:||...:|:.||||:.   |.:.:|.|.
Zfish    25 AIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGWVMVAAHCVE---ALRKWTVAL 86

  Fly   137 VFADV---EDSVEELQVTHRDFIIYPDY----LGFGGYSDLALIRLPRKVRTSEQVQPIEL--AG 192
            ...|:   |...:.:.|:  :..|:|::    :.||  .|:||:||......|..||...|  :|
Zfish    87 GDHDIYTHEGPEQYISVS--EVFIHPNWNPNNVAFG--YDIALLRLSIDATLSSYVQVATLPSSG 147

  Fly   193 EFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQ-YLDAEVIDQERCICYFLPGLVSQRRHLCTDG 256
            |.:.    .|....::||||.........:|.| |:  .|:|.|.|......|...:...:|..|
Zfish   148 EILP----YGHTCYITGWGYTETGGSLSAQLKQAYM--PVVDYETCSQKDWWGSSVKETMICAGG 206

  Fly   257 SNGRGACNGDSGGPVVYHWRNVSYLI-GVTSFGSAEGCEV-GGPTVYTRITAYLPWIRQ 313
            :....||:||||.|:...: |..|:: |||||.|.|||.. ..||.:||::||:.||.|
Zfish   207 TTSMSACHGDSGSPLNCLF-NGKYVVHGVTSFVSPEGCNTYKKPTGFTRVSAYINWINQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/246 (32%)
Tryp_SPc 77..314 CDD:238113 80/249 (32%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 78/246 (32%)
Tryp_SPc 30..265 CDD:238113 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.