DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:264 Identity:85/264 - (32%)
Similarity:125/264 - (47%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGAD---LVKCGGSLITLQFVLTAAHCLTDAIA---- 128
            |..|..|.||:.|....:|:||    .|...|   :..||||||..|:|||||||:...:|    
Mouse    23 AMTREGIVGGQEAHGNKWPWQV----SLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNK 83

  Fly   129 --AKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL- 190
              .::......:.|...:|.:: :||.||.|..|      .:|:||::|...|..|:.|.|:.| 
Mouse    84 VRVQLRKQYLYYHDHLMTVSQI-ITHPDFYIVQD------GADIALLKLTNPVNISDYVHPVPLP 141

  Fly   191 -AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRL-----LQYLDAEVIDQERCICYFLPGLVS-Q 248
             |.|    .|..|.:..::|||    :.|....|     |:.:...:|:...|...:..||:: .
Mouse   142 PASE----TFPSGTLCWVTGWG----NIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITGD 198

  Fly   249 RRHLCTD-----GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAY 307
            ..|:..|     |:.|..:|.||||||:|....:.....||.|:|  ||| :...|.:|||:|.|
Mouse   199 NVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWG--EGCAQPNRPGIYTRVTYY 261

  Fly   308 LPWI 311
            |.||
Mouse   262 LDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 81/257 (32%)
Tryp_SPc 77..314 CDD:238113 83/258 (32%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 83/258 (32%)
Tryp_SPc 29..265 CDD:214473 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.