DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and tmprss6

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:70 Identity:14/70 - (20%)
Similarity:21/70 - (30%) Gaps:26/70 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 VKNFQLMSAATVQPGSGSDGGALATRPSLSPQ-------------------------QPEQSNHD 321
            |.|| .||.|.:..|.|.....:.||.:....                         .||::|:.
 Frog   144 VTNF-WMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYK 207

  Fly   322 KIILH 326
            .:..|
 Frog   208 AVSYH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 10/56 (18%)
tmprss6XP_004913946.2 SEA 77..174 CDD:460188 10/30 (33%)
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.