DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and zgc:165423

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:257 Identity:78/257 - (30%)
Similarity:120/257 - (46%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGA 135
            |.:.|:|.||..|:.|.:|:|..|  ..||:..  ||||||:.|::|:||||.........|   
Zfish    32 APLNTKIVGGTNASAGSWPWQASL--HESGSHF--CGGSLISDQWILSAAHCFPSNPNPSDY--- 89

  Fly   136 TVFA-----------DVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE 189
            ||:.           :|..||.::       |::|.|.|....:|:||:.|...|..|..:||:.
Zfish    90 TVYLGRQSQDLPNPNEVSKSVSQV-------IVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVC 147

  Fly   190 LAGEFMHQNFLVGKVVTLSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLC 253
            ||.:   .:......:.::|||.:..... ...::||.::..::....|.|.:..|.......:|
Zfish   148 LAAD---GSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMC 209

  Fly   254 TD-GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            .. ...|:.:|.||||||:|....|.....||.|||  :|| :...|.||.|::.|..||.|
Zfish   210 AGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFG--KGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/248 (29%)
Tryp_SPc 77..314 CDD:238113 76/251 (30%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 73/248 (29%)
Tryp_SPc 38..269 CDD:238113 75/249 (30%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.