DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and plaua

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:291 Identity:82/291 - (28%)
Similarity:133/291 - (45%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLT 118
            ::..|.|      |.:....:|:|.||..:|....|:...:   ..|...: |||:|||..:|||
Zfish   147 QDTELTC------GERRLDRQTKIIGGLRSTVESQPWMAAI---FKGDGFI-CGGTLITPCWVLT 201

  Fly   119 AAHCLTDAIAAKIYTGATVFA----DVEDSVEELQVTHRDFIIYPDYLGFGGYS------DLALI 173
            ||||.......:|...:.|..    :..|.|:|.:.|....:|:.|:    .||      |:||:
Zfish   202 AAHCFPTGKRTQINRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDF----DYSTENYTHDIALL 262

  Fly   174 RL----------PRKVRTS-----EQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRL 223
            ::          .:.|||:     :|:.|             ||....::|:|.....|.|.:|.
Zfish   263 KIEDCNGQCAVKTKTVRTACLPPFQQMLP-------------VGFYCEIAGYGRYQKGTFKFSRY 314

  Fly   224 LQYLDAEVIDQERC-ICYFLPGLVSQRRHLCTDGSNGR-GACNGDSGGPVVYHWRNVSYLIGVTS 286
            |:..:.::|.|:.| ..|:....|::.. ||.:|.:.: .||.||||||:|....|:.:|.|:.|
Zfish   315 LKQTEVKLISQKVCQRTYYNKDEVNENM-LCANGRDWKTDACQGDSGGPLVCEVNNIMFLFGIIS 378

  Fly   287 FGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317
            :|. |..|...|.|||:::.|..||.|.|.:
Zfish   379 WGK-ECAEKNQPGVYTQVSNYNQWISQHTGL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/261 (28%)
Tryp_SPc 77..314 CDD:238113 76/263 (29%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.