DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and LOC100004427

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:256 Identity:66/256 - (25%)
Similarity:119/256 - (46%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHC-----LTDAI--A 128
            |.:.|:|.||..||.|.:|:|..:..:.:|...  |.||||:.::|||||.|     ::|.:  .
Zfish    30 APLNTKIVGGLNATEGSWPWQASINFKSTGQFF--CSGSLISERWVLTAASCFQRINVSDVVIYL 92

  Fly   129 AKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGE 193
            .::.|..:...::..:|.::.||                .|:||::|...|..::.::|:.||. 
Zfish    93 GRLTTNGSNPYEIPRTVIQVSVT----------------EDIALVQLSSSVTFTDYIRPVCLAA- 140

  Fly   194 FMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSN 258
             ....|:.|....::|||....:....:.:|:.::|.:::...  |..:.|:.:....:|....|
Zfish   141 -AGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIE--CSNINGITNLDNVICAGFVN 202

  Fly   259 --GRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQTA 316
              |:..|..|.|.|:|....:.....||..|   ..| :.|.||:|.|::.|..|||..|:
Zfish   203 ETGKAPCWEDFGSPLVTRQGSQWIQSGVVVF---TFCGQNGFPTLYARVSEYEEWIRNYTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 60/244 (25%)
Tryp_SPc 77..314 CDD:238113 63/246 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 60/244 (25%)
Tryp_SPc 36..257 CDD:238113 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.