DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:259 Identity:76/259 - (29%)
Similarity:130/259 - (50%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL---TDAIAAKIYTGATV 137
            ||.||..|:.|.:|:||.  ||: |::...||||:|...:||:||||.   ::..|..:|.|..:
Zfish    31 RIVGGVEASPGSWPWQVD--IQM-GSNGHVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGRHL 92

  Fly   138 FADVEDSVEELQVTHRDFIIYPD-YLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV 201
            . :..:..|::....|  ::.|: |....|..|:||::|...|..::::||:.|  .|....|..
Zfish    93 L-NGYNQFEKVSYVQR--VVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCL--PFADFQFNS 152

  Fly   202 GKVVTLSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGS-------- 257
            |.:..::|||:..:... .....|:.::..:|||..  |.|:..::|      :|.|        
Zfish   153 GTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSS--CQFMYQILS------SDSSTVDILSDM 209

  Fly   258 -------NGRGACNGDSGGPVVYHWRNVSYL-IGVTSFGSAEGC-EVGGPTVYTRITAYLPWIR 312
                   .|:.:|.||||||:|....|.::: .||.|||.  || :...|.:|:|::::...||
Zfish   210 ICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGL--GCAQKNRPGIYSRVSSFEKLIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/256 (29%)
Tryp_SPc 77..314 CDD:238113 75/258 (29%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.