DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss8

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:300 Identity:91/300 - (30%)
Similarity:136/300 - (45%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLAL---------ASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLS 58
            |.::|:|.|         ..||.|     |.:.|           |||.|..|..||:|:||.::
Mouse    15 VTILLLLGLLQSGIRADGTEASCG-----AVIQP-----------RITGGGSAKPGQWPWQVSIT 63

  Fly    59 FSSSAGSWWCGGSIIGNEWVLTAAHCTD------------GAASVTIYYGATVRTSPEFTQVVSS 111
            :.   |:..||||::.|:||::||||..            ||..:..|...||..:  ..|:::.
Mouse    64 YD---GNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHT--VAQIITH 123

  Fly   112 SKFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQA 175
            |.:|:..|      :.||:||:.|| |:||..:..|.|||.:.|:.  .|.....:|||   ..|
Mouse   124 SSYREEGS------QGDIALIRLSSPVTFSRYIRPICLPAANASFP--NGLHCTVTGWG---HVA 177

  Fly   176 TAVS----RDLQYVDLTIISNSKCQETFGSLIVTSR-------VLCVD-TTNKASTCQGDSGGPL 228
            .:||    |.||.:::.:||...|...:....|...       :||.. .......|||||||||
Mouse   178 PSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPL 242

  Fly   229 A--LDGV--LIGATSFGSADGCESGAPAAFTRITYYRDWI 264
            :  ::|:  |.|..|:|.|.|..: .|..:|..:.|..||
Mouse   243 SCPMEGIWYLAGIVSWGDACGAPN-RPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 80/253 (32%)
Tryp_SPc 40..267 CDD:238113 80/253 (32%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.